PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G197900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 207aa    MW: 24039 Da    PI: 6.0638
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G197900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92.1e-1952106357
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                        k++++++eq++ Le+ F +++++  e++ +LA +lgL+ +qV vWFqNrRa++k+
  Aqcoe5G197900.1.p  52 KKRKLSEEQVNLLENSFSNEHKLESERKDKLALELGLDPQQVAVWFQNRRARWKN 106
                        45689************************************************95 PP

2HD-ZIP_I/II116.91.1e-3752143293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        kkr+ls+eqv+lLE+sF++e+kLe+erK +la eLgl+p+qvavWFqnrRAR+k+k+lE++y++Lk++++    +++rLe+ev +L+e+l+e
  Aqcoe5G197900.1.p  52 KKRKLSEEQVNLLENSFSNEHKLESERKDKLALELGLDPQQVAVWFQNRRARWKNKKLEEEYSKLKASHEGAIVDKCRLEAEVLKLKEQLSE 143
                        9****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.82747107IPR001356Homeobox domain
SMARTSM003892.4E-1850111IPR001356Homeobox domain
SuperFamilySSF466891.37E-1851116IPR009057Homeodomain-like
PfamPF000461.6E-1652106IPR001356Homeobox domain
CDDcd000861.19E-1652108No hitNo description
Gene3DG3DSA:1.10.10.607.4E-2154114IPR009057Homeodomain-like
PRINTSPR000312.7E-57887IPR000047Helix-turn-helix motif
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PRINTSPR000312.7E-587103IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MNEVVVVGDE ELLFWYQEQQ QQQQCVQKTG ESSTRTRRRR KKSKGGEGNG MKKRKLSEEQ  60
VNLLENSFSN EHKLESERKD KLALELGLDP QQVAVWFQNR RARWKNKKLE EEYSKLKASH  120
EGAIVDKCRL EAEVLKLKEQ LSEAEKEIQK LSERCDELLI SSPNSSYSID TDPHFHGSFV  180
VEGFENLCVP EYNYGHGMDW VNLYNL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13754RRRKKSKGGEGNGMKKRK
23954RKKSKGGEGNGMKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025724.11e-68PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232081e-57ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU702e-57ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLB9HET53e-68B9HET5_POPTR; Homeobox-leucine zipper family protein
STRINGPOPTR_0007s12450.19e-68(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.17e-54homeobox protein 40